Função protéica

Report
Função protéica
(ou nanobiotecnologia sem criador)
Prof. Dr. Francisco Prosdócimi
• Aula baseada
no livro do Lehninger
(Nelson e Cox)
• Capítulo 5
• The cell
– Cap 11
Hormônios protéicos
• Hormônios que são proteínas
–
–
–
–
–
–
–
Prolactina
Hormônio de crescimento (GH, HGH)
Hormônio adenocorticotrófico (ACTH)
Vasopressina
Oxitocina
Insulina
Somatostatina, etc.
• Todos esses hormônios viajam no sangue e precisam ser reconhecidos e
incorporados em células específicas que são identificadas e reconhecidas
através de receptores protéicos ligados às membranas celular
Cascatas de regulação
• Proteínas viajam no sangue
até encontrar receptor de
membrana
• Interações proteínaproteína e proteína-ligante
regulam o metabolismo
celular
• Acionadas por proteínas de
membrana
• Reconhecem modificações
no meio externo e
modificam o ambiente
intracelular em resposta
A estrutura dinâmica das proteínas
• Ligação reversível a outras
moléculas: ligantes
– Permite resposta rápida a
modificações ambientais e
condições metabólicas
• Sítio de ligação: interage com o
ligante
– Complementar em tamanho,
forma, carga e afinidade à água
• A estrutura definida da proteína
é como uma foto, na realidade a
proteína opera de forma
dinâmica
O Ligante e o encaixe induzido
• O sítio de ligação discrimina entre
diferentes moléculas, ou seja, a
interação é específica
• Uma proteína pode ter sítio de ligação
para diversas moléculas
• Proteínas são flexíveis, vibram,
“respiram”
• Mudanças conformacionais (alostéricas)
são essenciais para a função protéica
• Encaixe induzido: adaptação estrutural
da proteína que se liga firmemente a ele
Teoria do caos e estrutura de proteínas
• Novas teorias dizem que o modelo
chave-e-fechadura está refutado
• A proteína fica em um estado de
movimentação dinâmica
razoavelmente caótico
– É o substrato induz a mudança
conformacional na proteína
• Complementaridade interativa: é
como se a chave moldasse a
fechadura ao encontrar com ela – ou
vice-versa
Modificações conformacionais
• Em uma proteína contendo várias subunidades, uma mudança
conformacional em uma delas normalmente afeta a
conformação das demais
• As ligações com os ligantes podem
ser reguladas por meio de
interações específicas (fosforilação,
glicosilação, etc.) ou por ligação
a outros ligantes
• Nas enzimas, os ligantes são
chamados substratos e o sítio
de ligação é chamado sítio
catalítico ou sítio ativo
• Palavras-chave: ligação,
especificidade e mudança
conformacional
Proteínas de ligação ao O2
• A mioglobina e a hemoglobina
são provavelmente as proteínas
mais estudadas do mundo
– Primeiras a terem estrutura 3D
conhecida
– Reação reversível de ligação ao O2
• Por que uma proteína?
– O2 é pouco solúvel em solução
aquosa (sangue)
Como ligar e transportar O2
• O problema: nenhuma cadeia lateral de
aminoácido é adaptada a ligar uma
molécula de oxigênio
– Sabe-se que metais de transição (Ferro e
cobre) ligam-se bem ao O2, mas...
– Ferro livre gera espécies reativas de
oxigênio
• Grupo prostético: composto associado
permanentemente a uma proteína e que
contribui para sua função
• O grupo heme: anel de protoporfirina,
seis ligações
A mioglobina
• 154 aa; 16700 Kda
• Encontrada no tecido
muscular de mamíferos
– Em focas e baleias guarda
O2 para mergulhos longos
• Globina (prot. globular)
– 8 α-hélices – 78% dos resíduos
• Ligações proteína-ligantes são
descritas por expressões de
equilíbrio
P+L
PL
>gi|44955888|ref|NP_976312.1|
myoglobin [Homo sapiens]
MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIR
LFKGHPETLEKFDKFKHLKSEDEMKASEDLKK
HGATVLTALGGILKKKGHHEAEIKPLAQSHAT
KHKIPVKYLEFISECIIQVLQSKHPGDFGADA
QGAMNKALELFR KDMASNYKELGFQG
Hemoglobina
• Proteína tetramérica
quase esférica com 4
grupos heme
– 2 cadeias alfa
– 2 cadeias beta
• <50% de similaridade
na cadeia primária!!
– Estrutura 3D muito
similar
Eritrócitos
• Eritrócitos são células altamente
especializadas em transportar
O2
– Perderam núcleo, mito, retículo
– Vivem 120 dias
– 34% de seu peso total é de
hemoglobina
• Hemoglobina está 96% saturada
no sangue arterial e 64% no
sangue venoso
• o CO tem mais afinidade à
hemoglobina do que o O2
Proteínas alostéricas
• Hemoglobina possui 2 tipos
de estados conformacionais:
T(enso) e R(elaxado)
• A ligação do O2 à
subunidade da hmb no
estado T desencadeia
mudança para o estado R
• Em proteínas alostéricas,
como a Hmb, a interação
com um ligante altera as
propriedades de ligação a
outros sítios da mesma
proteína
A hemoglobina também carrega o CO2
• Liga CO2 de forma inversamente
proporcional quando
relacionado à ligação com o
oxigênio
• CO2 liga-se como grupo
carbamato ao grupo amino do
aminoácido que está no Nterminal
• Os carbamatos formam pontes
salinas adicionais que auxiliam
na estabilização do estado T e
provem liberação do O2
A ligação do O2 à hmg é regulada por BPG
• 2,3 bisfosfoglicerato
• Presente em alta concentração nos
eritrócitos
• Uma molécula ligada para cada
hemoglobina – estabiliza o estado T
– Dificulta a ligação do O2 à hmg
• Quantidade de O2 liberada nos tecidos é
~40% da quantidade máxima transportada
no sangue – regulado com altitude
• Excesso de BPG => hipoxia
Funcionamento inadequado do pulmão
• Feto tem hemoblogina que é mais afim de
O2 do que a da mãe
Anemia falciforme
• A mutação homozigota (aa) de um
único nucleotídeo que codifica para a
cadeia B da hemoglobina faz com que
a forma da hemácea seja modificada
– Não há cura, transporte ineficiente de
O2
• Por outro lado, o heterozigoto (Aa)
possui maior resistência à malária já
que o Plasmodium não consegue
infectar tão bem as hemáceas
falciformes
– Qual o tipo de tratamento que se dá à
doenças genéticas?
Interações protéicas moduladas
por energia química (ATP)
Prof. Dr. Francisco Prosdocimi
Citoesqueleto
• Rede de filamentos protéicos que
se prolongam no citoplasma
• Rede estrutural da célula
– Define formato e organização geral
do citoplasma
• Responsável pelos movimentos
celulares
– Transporte interno de organelas
– Transporte de cromossomos na
mitose
• Estrutura dinâmica
– Organizado e desorganizado
(divisão celular)
Composição do
citoesqueleto
• Formados por três tipos principais
de filamentos arranjados em
conjunto e associados a organelas e
à membrana por proteínas
acessórias
– Filamentos de Actina
– Filamentos intermediários
– Microtúbulos
• Funções
– Motilidade celular, transporte de
organelas, divisão celular e outros
tipos de transporte celular
FA
FI
MT
Filamentos do citoesqueleto
• Cada tipo de filamento do
citoesqueleto é um polímero
construído a partir de subunidades
menores (monômeros)
• Podem difundir-se rapidamente
pelo citoplasma
• Proteínas acessórias associam-se
ao citoesqueleto
• Os polímeros do citoesqueleto são
mantidos por ligações fracas (não
covalentes)
Actina
•
Proteína globular, principal proteína do
citoesqueleto
– 20% das proteínas totais de uma célula
– Leveduras: um gene; Mamíferos: 6 genes
•
Uma das proteínas mais conservadas sendo
90% idêntica desde os fungos até os
mamíferos
•
Usada frequentemente como controle negativo
•
Quando polimerizada forma filamentos do
citoesqueleto
•
Participa da contração muscular, mobilidade
celular, divisão celular, citocinese,
movimentação de vesículas e organelas,
sinalização celular, estabilização e
manutenção das junções celulares, formato
celular
•
Interage com as membranas celulares
Filamentos de Actina
• Microfilamentos formam feixes ou
redes tridimensionais com
propriedades de géis semi-sólidos
• O arranjo e a organização dos
filamentos, as ligações entre feixes e
redes e estruturas celulares são
regulados pela ligação com uma
variedade de proteínas de associação
com a actina
• Os filamentos são particularmente
abundantes junto à membrana
plasmática
– Suporte mecânico e forma celular
– Movimento da superfície celular
Microfilamentos de actina
• Cada monômero de actina faz
uma rotação no filamento, que
apresenta estrutura de hélice de
dupla cadeia
• Possui uma polaridade que será
importante para a definição do
movimento da miosina
• Polimeriza espontaneamente em
condições fisiológicas
– Polimerização reversível
(dinâmica)
• Extremidade positiva cresce de 5
a 10 vezes mais rápido do que a
negativa
Organização dos filamentos
• Feixes de actina
– Filamentos ligados em agrupamentos paralelos
– Proteínas empacotadoras de actina
• Redes de actina
– Arranjo ortogonal
Feixes paralelos
• Responsáveis pelas
microvilosidades das
membranas
Redes de actina
• Filamentos de actina
ligados por proteínas
filaminas
• Ligações ortogonais
– Malha tridimensional
frouxa
• Sustentação da superfície
da célula
Adesão celular
• Responsáveis pelo contato com células adjacentes
• Fibras de estresse
– Fibras de actina que promovem adesão celular
• Fibras de alfa-actinina ligam cateninas e caderinas
• Contato célula-célula
– Junções de adesão
Projeções de membrana
• Microvilosidades intestinais
• Estruturas de resposta a estímulo
– Formadas por formação e retração de feixes de actina
• Pseudópodos
• Microespículas
Resumo: filamentos de actina
•
•
•
•
A: Microvilosidades
B: feixes contráteis citoplasmáticos
C: Protrusões em forma de lâmina e em forma de dedo
D: Anel contrátil durante a divisão celular
Actina, miosina e o movimento celular
• Filamentos de actina estão
associados a proteínas miosinas,
responsável por movimentos
celulares
• A miosina é motor molecular
– Converte ATP em energia mecânica
– Gera força e movimento
• Responsável pela contração
muscular, divisão celular,
movimentações celulares
Miosinas
• Reconhecidas originalmente como
ATPases presentes em músculos lisos e
estriados
• Conservadas na cabeça (liga actina e
hidrolisa ATP), mas variáveis na cauda
(interação com moléculas)
• Genoma humano possui
aproximadamente 40 genes diferentes
para miosinas
• Forma define a velocidade
com a qual se deslocam
nos feixes de actina
Contração muscular
• Especialização das células musculares
• Músculo como modelo para o estudo
do movimento em nível celular e
molecular
• Músculos
– Estriado esquelético: movimentos
voluntários
– Estriado cardíaco: bombeia sangue do
coração
– Liso: movimentos involuntários do
estômago, intestino, útero e vasos
sanguíneos
Músculo esquelético
• São feixes de fibras musculares
• Citoplasma composto de miofibrilas
– Filamento espessos de miosina
– Filamentos finos de actina
• Sarcômeros
– Cadeia de unidades contráteis
Sarcômeros
• Proteínas titinas
– Ligam miosina da linha M
até o disco Z
• Modelo do filamento
deslizante (1954)
–
–
–
–
–
Contração do sarcômero
Aproximação dos discos Z
Banda A não sofre alteração
Bandas I e H desaparecem
Deslizamento dos filamentos de
actina
Linha M
O modelo do filamento deslizante
• As cabeças globulares da
miosina ligam-se à actina
– Ligação entre filamentos finos e
espessos
• A miosina movimenta seus
domínios globulares sobre os
filamentos de actina em direção
ao terminal positivo
Modelo da ponte pênsil
• Além de ligar-se à actina, as
regiões globulares da miosina
ligam-se e hidrolisam o ATP, que
fornece a energia para a
realização do deslizamento
• Deslizamento dos feixes de
miosina sob os feixes de actina
Miosinas não-convencionais
• Não formam filamentos
• Envolvidas em outros tipos de movimentos celulares
– Transporte de vesículas e organelas
– Fagocitose, emissão de pseudópodos
• Caudas se ligam a organelas
• Movimentação sob o
esqueleto de actina
Microtúbulos
• Cilindros ocos de 25nm de
diâmetro
• Estruturas dinâmicas em
constante processo de
organização e desorganização
• Definem a forma da célula
• Promovem locomoção,
transporte intracelular de
organelas e separação dos
cromossomos durante a mitose
Tubulina
• Proteína globular
• Arranjos das formas
alfa e beta formam os
microtúbulos
Estrutura dos microtúbulos
• Formado por dímeros de tubulinas
alfa e beta
• Formados por 13 filamentos
lineares organizados em volta do
centro do túbulo
• Assim como os filamentos de actina são estruturas polares
– Extremidade positiva: crescimento rápido
– Extremidade negativa: crescimento lento
• A polaridade interfere na direção do movimento ao longo do
microtúbulo
Instabilidade dinâmica
• Tubulina ligada a GTP é incorporada ao microtúbulo
• A adição de tubulina-GTP ocorre mais rápido do que a
hidrólise do GTP -> formação de cap GTP
• Na falta de moléculas de GTP ligadas a tubulina, a
hidrólise ocorre de forma
mais rápida e o
complexo é despolimerizado
• Remodelamento dos
microtúbulos é importante na mitose
Microtúbulos, drogas e câncer
• Drogas que se ligam à
tubulina, como a colchicina e
a colcemida inibem a
polimerização de
microtúbulos
• Inibem assim a divisão
celular (mitose)
• Outras drogas que se ligam
aos microtúbulos são
também utilizadas no
tratamento de câncer, como
vincristina e vimblastina
Centríolo, centrossomo e
organização dos microtúbulos
• Microtúbulos se estendem a
partir de um centro
organizador de microtúbulos
– O centrossomo se localiza
junto ao núcleo
• Durante a mitose os
centrossomos formam os
fusos mitóticos, responsáveis
pela separação dos
cromossomos nas células
filhas
Centrossomos
• Formados por um par de centríolos organizados
perpendicularmente, circundados pelo material pericentriolar
• Centríolo: estrutura cilíndrica formada por 9 tripletes
de microtúbulos
• Funções de organização
dos microtúbulos pelo
centrossomo
Organização dos
microtúbulos na mitose
• Organização do fuso mitótico: responsável
pela separação dos cromossomos homólogos
• Centríolo e componentes do centrossomo
são inicialmente duplicados
• Os dois centrossomos são então localizados
em cada um dos lados do núcleo
• Na mitose ocorre despolimerização e
retração geral dos microtúbulos
Microtúbulos motores e movimentos
• Responsáveis por movimentos celulares, transporte
intracelular, posicionamento de vesículas e organelas,
separação dos cromossomos, batimento de cílios e flagelos
• Assim como no caso da actina a movimentação é realizada
por proteínas motoras que usam a energia do ATP
• Cinesinas e dineínas fazem aqui o papel da miosina
Cinesinas e dineínas
• Movem-se em direções opostas ao longo dos
microtúbulos
– Cinesina: move-se para a extremidade positiva
– Dineína: extremidade negativa
• Cerca de 100 diferentes cinesinas em humanos
Transporte de organelas
• Neurônios com metros de comprimento precisam ter
moléculas transportadas para o axônio
• Vesículas secretoras vindas do Golgi são
transportadas ao longo dos microtúbulos aos axônios
Separação dos cromossomos mitóticos
• Ocorre durante a anáfase
• Anáfase A
– Movimento dos cromossomos em
direção ao polo do fuso
• Anáfase B
Separação dos
polos do fuso
Cílios e Flagelos
• Projeções de membrana
formadas por microtúbulos e
responsáveis pelo movimento de
células eucarióticas
• Flagelos de bactérias são
protéicos (não tubulina)
• Estrutura em
axonema
(9+2)
Sistema imunológico
Prof. Dr. Francisco Prosdocimi
Proteínas e imunologia
• A maioria das interações proteína-ligante não envolve
grupo prostético
• Discriminação efetiva do ligante é na forma de sítio de
ligação proteína-proteína
• Resposta imunológica
– A distinção molecular entre “próprio” e “não-próprio”
– Teoria de rede
– O sistema homeostático bioquímica é altamente sensível
e desenvolvido através das reações entre ligantes e
proteínas
Sistemas imunológicos
• Imunidade celular
– Células hospedeiras infectadas por vírus,
parasitas e tecidos estranhos
– Linfócitos T
• Parasitas possuem receptores de células Tc
• Células T auxiliares produzem proteínas
sinalizadoras (citocinas)
• Imunidade humoral
– Infecções bacterianas e virais, proteínas
estranhas
– Anticorpos ou imunoglobulinas (Ig)
– 20% das proteínas do sangue são Igs
produzidas pelos linfócitos B
Proteínas imunológicas
• Proteínas de reconhecimento
altamente específicas (humanos
teem 108 anticorpos com
especificidades diferentes)
– Receptor de célula T
– Anticorpo produzido por célula B
• Antígeno: molécula que induz
resposta imunológica
– Epitopo: determinante antigênico,
região da molécula reconhecida
• Imunoglobulinas (ig’s): formadas por
4 cadeias polipeptídicas, sendo 2
pesadas e 2 leves
Imunoglobulinas
• Ligação específica entre
antígeno e anticorpo
• Imunoglobulinas podem ser
encontradas em monômeros,
dímeros, trímeros, multímeros
• Marcação do patógeno para
engolfamento por macrófagos
Ligação antígeno-anticorpo
• Firme e específica
• É a base para procedimen-tos
analíticos importantes
• Anticorpo
– policlonal: reconhecido por várias
células B diferentes
– Monoclonal: reconhecidos pela
mesma população de células B
• Anticorpo pode ser ligado a uma
resina cromatográfica para
separação de uma proteína
específica
• Exames sorológicos: detecta
presença e quantidade do antígeno
• Immunoblot
Conclusões
•
•
•
•
As proteínas teem inúmeras funções celulares
A estrutura da proteína é altamente relevante para que ela tenha uma função
celular
O contato proteína-proteína regula muitas funções intra e intercelulares
(receptores de membrana)
As proteínas mudam de conformação quando encaixadas a um ligante
– A ligação reversível da proteína ao ligante é importante na regulação do metabolismo
– Sítios de ligação podem ligar diferentes moléculas, algumas com mais afinidade do que o
ligante desejado
•
•
•
•
Proteínas interagem para a formação do citoesqueleto e contração muscular,
gastando energia química
Polimeração e despolimerização de complexos poliméricos acontecem em todo o
instante nas células
Proteínas podem ligar moléculas indiretamente -- através de grupos prostéticos
Há um controle dos ligantes mais comuns dentro de um organismo e a presença
de novas moléculas desconhecidas aciona o sistema imune
• Aula baseada
no livro do Lehninger
(Nelson e Cox)
• Capítulo 5
• The cell
– Cap 11

similar documents