Az előadás diái

Report
A daganatképződés, a daganat fejlődése és terjedése többlépcsős
folyamat, amely mutációk, genetikai és sejtbiológiai változások
sorozatára vezethető vissza. E változásokon keresztül a
daganatsejtek egyre több képességet szereznek, amelyek lehetővé
teszik, hogy növekedjenek, majd terjedjenek és áttéteket
képezzenek.
Klonális eredet?
Korábbi elképzelés
Ma: ismert, hogy a tumorok
többféle sejttípusból állnak
Onkogének és tumorszuppresszor gének
jelátvitelben betöltött szerepe
Sejtszaporodás
(sejtciklus)
Genom- stabilitás
fenntartása
(hibajavítás)
Apoptózis
Mutáció
tumorokban
ONKOGÉNEK
(protoonkogének)
SZUPPRESSZOR
GÉNEK
serkentés
gátlás
-
igen
gátlás
funkciónyeréssel járó
mutációk
serkentés
funkcióvesztéssel járó
mutációk
Néhány onkogén és tumorszuppresszor gén, amelyek mutációi
gyakran előfordulnak különböző tumorokban
GENE
CLASS
PATHWAY
TUMORS WITH
AFFECTED
MUTATIONS (%)
K-Ras
oncogene
receptor tyrosinekinase signaling
40
β-catenin
oncogene
Wnt signaling
5–10
p53
tumor suppressor
stress/geneticdamage response
60
APC
tumor suppressor
Wnt signaling
> 60
Smad4
tumor suppressor
TGFβ signaling
30
TGFβ receptor II
tumor suppressor
TGFβ signaling
10
MLH1 and other
DNA
tumor suppressor
DNA mismatch
repair
15
mismatch repair
genes
(often silenced by
methylation)
Hallmarks of Cancer: a tumorsejtek sajátosságai
növekedési szignálok
folyamatos fenntartása
rezisztencia a
sejthalállal szemben
érképzés indukciója
növekedést gátló
szignálok elkerülése
invázió és metasztázis aktiválása
halhatatlanság
Cell (2011) 144:646-
A VASTAGBÉLRÁK KIALAKULÁSÁNAK GENETIKAI MODELLJE
(Vogelstein, 1990)
A
C
B
DNA
metilálás
elvesztése
5
APC
Hiperproliferatív
epitélium
12
Középső
adenóma
Korai
adenóma
D
E
17
18
TP53
DCC
Késői adenóma
Ras
mutáció
Karcinóma
A tumorsejtek genetikai állománya instabil
A metasztázis többlépcsős folyamat eredménye
A metasztázis folyamata
Metasztázis szuppresszor gének (MSGs)
 Gátolják a makroszkópikus
kísérletekben is).
áttét
képződést
(in
vivo
 A primer tumorban kifejeződnek, az áttétben viszont nem
vagy csökkent mértékben expresszálódnak.
 Eltérőek az onkogénektől és tumorszuppresszor génektől.
 A primer tumor növekedésére nincs hatásuk.
 A metasztatikus kaszkád különböző lépéseiben hatnak.
Horak et al., APMIS 116: 586-601, 2008
E-cadherin expresszió elvesztése:
kulcs az EMT (epiteliálismesenchymális tranzíció)
folyamatához, majd az invázióhoz
• A sejt adhéziós kapcsolatok egyik fő
komponense az E-cadherin.
• Az E-cadherin és az aktin citoszkeleton
között a citoplazmatikus sejt adhéziós
komplex révén a β-catenin létesít
kapcsolatot.

Metasztázisokban alacsony E-cadherin
szint
→
hiányában
a
β-catenin
felhalmozódik a citoplazmában →
abnormális TCF/LEF aktiváció
EMT: epiteliális – mesenchymális tranzíció
A TGF- β aktivációja a Smad-interacting fehérjéken, a Snail és Slug-on
(cink-ujj transzkripciós faktorok) keresztül az E-cadherin repressziójához
vezet, ami a β -catenin „kiszabadulásán” és TCF/LEF aktivációján keresztül
EMT-hez vezet. A sejtek motilitása fokozódik, mátrix-degradáló enzimek
(MMP-k) expresszálódnak, a sejtek rezisztensebbé válnak az apoptózissal
szemben.
EMT: epiteliális – mesenchymális tranzíció
Lee et al., 2006, J. Cell Biol, 172: 973-81.



A primer tumorsejtek bekerülnek véráramba, sorsuk függ attól, hogy expresszálják-e a
Kai1 MSG-t
→ ha van Kai1 marker → interakció DARC receptorral (Duffy antigen receptor for
chemokines)→ szenescens jel, a cdk inhibitor p21 fokozott expresszióját eredményezi,
így a tumor sejt nem képes az S fázisba belépni
→ ha nincs Kai1 marker → tumorsejtek osztódnak → metasztázis képzés
p53 mutáció Kai1
down-regulációt okoz:
metasztázis
előrehaladott állapota
Iiizumi et al., 2007 Cancer Res. 67: 1411-4
MKK4: a MAP2K család tagja, aktivációja a JNK/p38
MAPK modulon keresztül apoptózist ill. a sejtciklus
leállását eredményezi
• MKK4-et
ektopikusan
kifejező
tumorsejtek
képtelenek új
kolónia
formálására
célzott terápia
Az MSG-k a metasztatikus kaszkád különböző
folyamataiban hatnak
• Az
E-cadherin
az
elsődleges tumorból való
kiszakadás, az invázió
kezdeti lépéseiben hat.
• A Kai1 a migráló sejtek
erekből való kilépését
akadályozza meg.
• Az MKK4 és az Nm23-H1
pedig
a
másodlagos
tumor
növekedést
befolyásolják.
Metasztázis
szuppresszor
gének
• Megismerésük lehetőséget ad olyan
klinikai
markerek
fejlesztésére,
amelyek kimutatnák a szövettani
elváltozásokat
és
a
metasztázis
képződését.
• Potenciális gyógyszer célpontok a
metasztatikus
tumorsejtek
alvó
fázisban tartásához.
Aguirre-Ghiso J. A. (2007), Nat.Rev. Cancer,
7: 834-46
Caenorhabditis elegans,
mint genetikai modell
Előnyei:
1. Laboratóriumban könnyen fenntartható
2. Egyszerű anatómia (959 szomatikus sejt, 302 neuron, átlátszó testfal)
3. Kis testméret (1.2 mm)
4. Nagyszámú utódnemzedék (250 utód)
5. Gyors életciklus
6. Speciális szexuális dimorfizmus: öntermékenyítő hermafroditák és hímek
7. Invariáns sejtleszármazás
A C. elegans nm23-H1/2 ortológ ndk-1 lf mutációja
sterilitást és kitüremkedő vulva fenotípust okoz
Nm23-H1
Nm23-H2
NDK-1
MANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVW 78
MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVW 78
MSNTERTFIAIKPDGVHRGLVGKIIARFEERGYKLVALKQMTASKAHLEVHYQDLKDKPFFPSLIEYMSSGPVVAMVW 78
*:* ************:*****:** ***::*::**.:* : **: *: ** ****:***..*::** *********
Nm23-H1
Nm23-H2
NDK-1
EGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTS-CAQNWIYE 152
EGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKS-CAHDWVYE 152
QGLDVVKQGRSMLGATNPLASAPGTIRGDFCIQTGRNICHGSDAVDSANREIAHWFKQEEINDYASPFINSWVYE 153
:**:*** ** *** *** * ***********.**** ****:*.**::**. **: **: ** *
:.*:**
LGI
ATG
1
TAA
deléció: ok314
-523
Fenotípus:
sterilitás, vulva fejlődési defekt
600
634
Masoudi N, …Takács-Vellai K (2013)
Development 140, 3486-3495
Takács-Vellai K (2014)
J Mol Signal (in press)
ndk-1(ok314)
Tumorfejlődés a C.elegans csíravonalában
Kirienko et al. (2010) Dev. Dyn. 239:1413–1448
A DTC-k speciális vezető sejtek, amelyek a gonád alakját alakítják ki
vándorlásuk során.
Wild type
ndk-1(ok314)
Egy menekítő, transzlációs NDK-1::GFP konstrukció expresszálódik a DTC-kben.
gonad arm
DTC
NDK-1::GFP
L4 larva
Az NDK-1 overexpressziója a humán Nm23-H1/2-höz
hasonlóan gátolta egy invazív emlőkarcinóma sejtvonal
migrációs potenciálját
MDA-MB-231T
300
Number of cells
250
200
150
100
50
0
K1
K2
HA1
HA2
CE1
CE2
HB1
HB2
Clones
Fancsalszky L. …M. Herak Bosnar…Takács-Vellai K., PlosOne 2014, 9(3):e92687
A DTC migráció és az apoptotikus testek bekebelezése
analóg folyamatok: közös géneket használnak
Wu YC and Horvitz HR, Nature, 1998
Mindkét folyamat membránok átszervezését és a
citoszkeleton átalakítását igényli.
B. Conradt, D. Xue, Wormbook, 2005

INA-1
According to B. Conradt and D. Xue, Wormbook, 2005
Az ndk-1(-) mutáns embriókban és RNSi-kezelt állatok
gonádjában felhalmozódnak az apoptotikus testek
ndk-1(RNAi)
NDK-1::GF
NDK-1::GF
I
Az NDK-1::GFP az
apoptotikus testek
körül fejeződik ki a
gonád tok sejtjeiben
Fancsalszky L….Takács-Vellai
K., Plos One (2014)
vab-3
Pax6
ced-7
Abc1
unc-73
Trio
ina-1
-integrin
ced-1
Megf10
mig-2
RhoG
ced-2
CrkII
ced-6
Gulp
dyn-1
Dynamin
ced-5
Dock180
ced-12
Elmo
abl-1
Abl
abi-1
Abi
ced-10
Rac1
ndk-1
Nm23
engulfment
DTC migration and engulfment
Az apoptotikus bekebelezés jelátviteli útvonalai az aktin
polimerizációhoz vezetnek
Shen Q et al. Development 2013;140:3230-3243
2000-2011: 4 új jellegzetesség
az energiaháztartás
újraprogramozása
a daganatsejtek
genomja instabillá
válik
az immunrendszer
sejtpusztító
folyamatainak
elkerülése
tumor progressziót
segítő gyulladások
Tumor progressziót elősegítő gyulladás
A tumorokba a
veleszületett és
az adaptív
immunrendszer
sejtjei is
infiltrálódnak, és
gyulladáshoz
hasonló
körülményeket
tükröznek.
A tumorasszociált
gyulladási válasz
– paradox
módon - a
tumor
progressziót
segíti.
A tumor mikrokörnyezetében lévő immunsejtek tumor
progressziót elősegítő faktorokat termelnek
Az immune inflammatory sejtek által termelt faktorok:
-EGF,
-VEGF, FGF2 (angiogenic),
-chemokines, cytokines
-matrix metalloproteinases (MMP-9, invasion)
Potential significance of our work...
NDPK funkció
hiánya
Apoptotikus testek felhalmozódása
Gyulladás
J. Martinez et al., PNAS, 2011
Gyulladás
Kedvező körülmény a tumor progresszióhoz
Hanahan D and Weinberg R, Cell, 2011
Köszönöm a figyelmet!
Iiizumi M et al., Biochim Biophys Acta. 2008 December ; 1786(2): 87–
Iiizumi M et al., Biochim Biophys Acta. 2008 December ; 1786(2): 87–104.

similar documents